PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_27980
Common NameKK1_028474
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 124aa    MW: 14317.5 Da    PI: 9.5029
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_27980genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB118.14.1e-37188895
          NF-YB  8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                   +Pi+nv++i +k+lP+nakis+ ake++q+ +++fi+fvt +a ++cq e rk +n +d+lwa+ +lGf+dyv pl+v+l++yr++e+
  C.cajan_27980  1 MPITNVTKITRKILPNNAKISDSAKEMIQQSATKFITFVTRKAKERCQSEYRKIMNVEDMLWAIQKLGFDDYVGPLTVFLQRYRDIER 88
                   8*************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.108.4E-33192IPR009072Histone-fold
SuperFamilySSF471138.78E-27195IPR009072Histone-fold
PfamPF008088.8E-18164IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.9E-102846No hitNo description
PRINTSPR006152.9E-104765No hitNo description
PRINTSPR006152.9E-106684No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 124 aa     Download sequence    Send to blast
MPITNVTKIT RKILPNNAKI SDSAKEMIQQ SATKFITFVT RKAKERCQSE YRKIMNVEDM  60
LWAIQKLGFD DYVGPLTVFL QRYRDIERGD SSTYHPPLPP PVHSSGPNFS MDPNTNTEMC  120
HPKW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-25185993NF-YB
4awl_B1e-251851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-251851094NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007146648.11e-49hypothetical protein PHAVU_006G057800g
SwissprotQ9SFD84e-36NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A151S4S07e-91A0A151S4S0_CAJCA; Nuclear transcription factor Y subunit B-9
STRINGGLYMA07G29695.18e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.13e-36NF-YB family protein